PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc033226.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 223aa    MW: 25519.6 Da    PI: 9.3403
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc033226.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM98.59.8e-3168055129
                      NAM  55 ekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              ekewy Fs++dkky++g+r+nrat++g+Wkatg+dk ++ ++++ +g++ktLvfykgrap+g+k+dW+mheyrle
  Itr_sc033226.1_g00001.1   6 EKEWYLFSQSDKKYPSGSRRNRATSAGFWKATGRDKVIYGNNRRIIGMRKTLVFYKGRAPRGQKSDWIMHEYRLE 80 
                              68***********************************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100539.0231100IPR003441NAC domain
SuperFamilySSF1019412.75E-355100IPR003441NAC domain
PfamPF023653.3E-14979IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MGLTPEKEWY LFSQSDKKYP SGSRRNRATS AGFWKATGRD KVIYGNNRRI IGMRKTLVFY  60
KGRAPRGQKS DWIMHEYRLE LDNNHTTSHD GWVVCRLFKK KKNMHQKALD NNPGGVLDQM  120
NETQSTNSEE LISSPSCQSF EDIMFDETKN TITPLSRGWV ALDRLAASHL DTSKHLTTAH  180
SGDYLNNFLH LPFHYDHGSG LINLCASIRP NDDPHHQISQ VNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-33210666171NO APICAL MERISTEM PROTEIN
1ut4_B7e-33210666171NO APICAL MERISTEM PROTEIN
1ut7_A7e-33210666171NO APICAL MERISTEM PROTEIN
1ut7_B7e-33210666171NO APICAL MERISTEM PROTEIN
4dul_A7e-33210666171NAC domain-containing protein 19
4dul_B7e-33210666171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011081420.15e-53PREDICTED: NAC domain-containing protein 12-like
SwissprotQ84WP61e-49NAC43_ARATH; NAC domain-containing protein 43
TrEMBLW9RNU14e-49W9RNU1_9R
STRINGSolyc10g005010.2.11e-48(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.16e-51NAC family protein